PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01037026001
Common NameLOC100242931, VIT_03s0088g00590, VITISV_024203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 195aa    MW: 22012.5 Da    PI: 9.7759
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01037026001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.72.7e-221763349
                       --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       i  k   qvtfskRr g++KKA+EL++LC+a+va+i+fs+ gk++ +
  GSVIVT01037026001 17 IPKKNHLQVTFSKRRSGLFKKASELCTLCGANVAIIVFSPAGKVFSF 63
                       55677789************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-32766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.53767IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-28887IPR002100Transcription factor, MADS-box
CDDcd002653.40E-34875No hitNo description
PRINTSPR004045.0E-19929IPR002100Transcription factor, MADS-box
PfamPF003192.4E-241663IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-192944IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-194465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MVKKPSKGRQ KIEISKIPKK NHLQVTFSKR RSGLFKKASE LCTLCGANVA IIVFSPAGKV  60
FSFGHPDVES IVDRFFTVRE LNLQLTQVLN QLEAEKKRGE ILSQMRRASQ TQCWWEAPIN  120
ELSMPELEQL KVSMEELKKV VLSQGDKLLM EAANPSPFYM INGSSAMVDH FEIERKPSEI  180
HGNVHNFGYG QGFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-15899292Myocyte-specific enhancer factor 2B
1tqe_R3e-15899292Myocyte-specific enhancer factor 2B
1tqe_Q3e-15899292Myocyte-specific enhancer factor 2B
1tqe_P3e-15899292Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4418280.0AM441828.2 Vitis vinifera contig VV78X276199.7, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270964.11e-138PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK22e-52AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA5AZX61e-138A5AZX6_VITVI; Putative uncharacterized protein
STRINGVIT_03s0088g00590.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-46AGAMOUS-like 62
Publications ? help Back to Top
  1. Velasco R, et al.
    A high quality draft consensus sequence of the genome of a heterozygous grapevine variety.
    PLoS ONE, 2007. 2(12): p. e1326
    [PMID:18094749]